GUCY1B3 Antikörper (N-Term)

Produktnummer ABIN634375

Produktdetails anti-GUCY1B3 Antikörper

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GUCY1B3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GUCY1 B3 antibody was raised against the N terminal of GUCY1 3

Aufreinigung: Affinity purified

Immunogen: GUCY1 B3 antibody was raised using the N terminal of GUCY1 3 corresponding to a region with amino acids LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GUCY1B3 Blocking Peptide, catalog no. 33R-5041, is also available for use as a blocking control in assays to test for specificity of this GUCY1B3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUCY0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GUCY1B3

Target: GUCY1B3 (Guanylate Cyclase 1, Soluble, beta 3 (GUCY1B3))

Andere Bezeichnung: GUCY1B3 (GUCY1B3 Produkte)

Synonyme: GUCY1B3 antikoerper, AMGC1 antikoerper, AmsGC-beta1 antikoerper, AmsGCbeta1 antikoerper, GB20021 antikoerper, Gucy1b3 antikoerper, gucy1b3 antikoerper, GC-S-beta-1 antikoerper, GC-SB3 antikoerper, GUC1B3 antikoerper, GUCB3 antikoerper, GUCSB3 antikoerper, GUCY1B1 antikoerper, SGCB1 antikoerper, GCbeta1 antikoerper, Gucy1b1 antikoerper, SGC antikoerper, guanylate cyclase 1 soluble subunit beta antikoerper, guanylate cyclase 1, soluble, beta 3 antikoerper, guanylate cyclase, soluble, beta 1 antikoerper, guanylate cyclase 1, soluble, beta 3 S homeolog antikoerper, guanylate cyclase 1 soluble subunit beta 3 antikoerper, GUCY1B3 antikoerper, gucy1b3 antikoerper, Gycbeta1 antikoerper, gucy1b3.S antikoerper, Gucy1b3 antikoerper

Hintergrund: Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis