RASGRP2 Antikörper

Produktnummer ABIN634377

Produktdetails anti-RASGRP2 Antikörper

Target: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASGRP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RASGRP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASGRP2 Blocking Peptide, catalog no. 33R-5537, is also available for use as a blocking control in assays to test for specificity of this RASGRP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGRP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASGRP2

Target: RASGRP2 (RAS Guanyl Releasing Protein 2 (Calcium and DAG-Regulated) (RASGRP2))

Andere Bezeichnung: RASGRP2 (RASGRP2 Produkte)

Hintergrund: The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain.

Molekulargewicht: 69 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg