DGKA Antikörper (N-Term)

Produktnummer ABIN634379

Produktdetails anti-DGKA Antikörper

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGKA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DGKA antibody was raised against the N terminal of DGKA

Aufreinigung: Affinity purified

Immunogen: DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGKA Blocking Peptide, catalog no. 33R-2431, is also available for use as a blocking control in assays to test for specificity of this DGKA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGKA

Target: DGKA (Diacylglycerol Kinase, alpha 80kDa (DGKA))

Andere Bezeichnung: DGKA (DGKA Produkte)

Synonyme: DAGK antikoerper, DAGK1 antikoerper, DGK-alpha antikoerper, 80kDa antikoerper, AW146112 antikoerper, Dagk1 antikoerper, dgka antikoerper, zgc:136759 antikoerper, dagk antikoerper, dagk1 antikoerper, dgk-alpha antikoerper, diacylglycerol kinase alpha antikoerper, diacylglycerol kinase, alpha antikoerper, diacylglycerol kinase, alpha 80kDa antikoerper, diacylglycerol kinase, alpha a antikoerper, diacylglycerol kinase alpha S homeolog antikoerper, DGKA antikoerper, Dgka antikoerper, dgkaa antikoerper, Tsp_02164 antikoerper, dgka antikoerper, dgka.S antikoerper

Hintergrund: The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways.

Molekulargewicht: 83 kDa (MW of target protein)