RASGEF1C Antikörper (Middle Region)

Produktnummer ABIN634380

Produktdetails anti-RASGEF1C Antikörper

Target: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RASGEF1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RASGEF1 C antibody was raised against the middle region of RASGEF1

Aufreinigung: Affinity purified

Immunogen: RASGEF1 C antibody was raised using the middle region of RASGEF1 corresponding to a region with amino acids FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RASGEF1C Blocking Peptide, catalog no. 33R-2957, is also available for use as a blocking control in assays to test for specificity of this RASGEF1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASGEF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RASGEF1C

Target: RASGEF1C (RasGEF Domain Family, Member 1C (RASGEF1C))

Andere Bezeichnung: RASGEF1C (RASGEF1C Produkte)

Synonyme: RASGEF1C antikoerper, 9130006A14Rik antikoerper, RasGEF domain family member 1C antikoerper, RasGEF domain family, member 1C antikoerper, RASGEF1C antikoerper, Rasgef1c antikoerper

Hintergrund: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Molekulargewicht: 53 kDa (MW of target protein)