OTUD6B Antikörper (Middle Region)
-
- Target Alle OTUD6B Antikörper anzeigen
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OTUD6B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OTUD6 B antibody was raised against the middle region of OTUD6
- Aufreinigung
- Affinity purified
- Immunogen
- OTUD6 B antibody was raised using the middle region of OTUD6 corresponding to a region with amino acids EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC
- Top Product
- Discover our top product OTUD6B Primärantikörper
-
anti-OTU Domain Containing 6B (OTUD6B) (AA 1-293) antibody
OTUD6B Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 234-262), (C-Term) antibodyOTUD6B Reaktivität: Human WB, FACS Wirt: Kaninchen Polyclonal RB27397 unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 31-323) antibodyOTUD6B Reaktivität: Human WB, IHC, IP Wirt: Kaninchen Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (AA 1-293) antibodyOTUD6B Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 3H4 unconjugated
anti-OTU Domain Containing 6B (OTUD6B) (C-Term) antibodyOTUD6B Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Huhn, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-OTU Domain Containing 6B (OTUD6B) antibodyOTUD6B Reaktivität: Human, Maus WB, FACS Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OTUD6B Blocking Peptide, catalog no. 33R-2473, is also available for use as a blocking control in assays to test for specificity of this OTUD6B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OTUD6B (OTU Domain Containing 6B (OTUD6B))
- Andere Bezeichnung
- OTUD6B (OTUD6B Produkte)
- Synonyme
- DUBA5 antikoerper, 2600013N14Rik antikoerper, AU015433 antikoerper, RGD1310024 antikoerper, zgc:56305 antikoerper, duba5 antikoerper, DKFZp459J184 antikoerper, OTU domain containing 6B antikoerper, OTU domain containing 6B S homeolog antikoerper, OTU domain containing 6B L homeolog antikoerper, OTUD6B antikoerper, Otud6b antikoerper, otud6b antikoerper, otud6b.S antikoerper, otud6b.L antikoerper
- Hintergrund
- Deubiquitinating enzymes are proteases that specifically cleave ubiquitin linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
- Molekulargewicht
- 37 kDa (MW of target protein)
-
