DIRAS1 Antikörper (N-Term)

Produktnummer ABIN634394

Produktdetails anti-DIRAS1 Antikörper

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DIRAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DIRAS1 antibody was raised against the N terminal of DIRAS1

Aufreinigung: Affinity purified

Immunogen: DIRAS1 antibody was raised using the N terminal of DIRAS1 corresponding to a region with amino acids PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DIRAS1 Blocking Peptide, catalog no. 33R-7059, is also available for use as a blocking control in assays to test for specificity of this DIRAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DIRAS1

Target: DIRAS1 (DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1))

Andere Bezeichnung: DIRAS1 (DIRAS1 Produkte)

Hintergrund: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly