MYD88 Antikörper
-
- Target Alle MYD88 Antikörper anzeigen
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MYD88 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR
- Top Product
- Discover our top product MYD88 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MYD88 Blocking Peptide, catalog no. 33R-9003, is also available for use as a blocking control in assays to test for specificity of this MYD88 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYD88 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MYD88 (Myeloid Differentiation Primary Response Gene (88) (MYD88))
- Andere Bezeichnung
- MYD88 (MYD88 Produkte)
- Synonyme
- MYD88D antikoerper, XMyD88 antikoerper, myd88d antikoerper, MGC84928 antikoerper, CG2078 antikoerper, DMMYD88 antikoerper, DmMyD88 antikoerper, DmMyd88 antikoerper, Dmel\\CG2078 antikoerper, EP(2)2535 antikoerper, Kra antikoerper, LD20892 antikoerper, MYD88 antikoerper, MyD88 antikoerper, Myd88F antikoerper, dMyD88 antikoerper, dMyd88 antikoerper, kra antikoerper, myd88 antikoerper, zgc:103541 antikoerper, GB12344 antikoerper, NV10640 antikoerper, myd88-a antikoerper, myd88-b antikoerper, myeloid differentiation primary response 88 antikoerper, myeloid differentiation primary response 88 S homeolog antikoerper, myeloid differentiation primary response gene 88 antikoerper, CG2078 gene product from transcript CG2078-RB antikoerper, myeloid differentiation primary response protein MyD88-A antikoerper, myeloid differentiation primary response protein MyD88 antikoerper, myeloid differentiation factor 88 antikoerper, myeloid differentiation primary response 88 L homeolog antikoerper, MYD88 antikoerper, myd88.S antikoerper, Myd88 antikoerper, myd88 antikoerper, LOC413194 antikoerper, LOC100118553 antikoerper, LOC575153 antikoerper, myd88.L antikoerper
- Hintergrund
- This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, TLR Signalweg, Neurotrophin Signalübertragung, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Toll-Like Receptors Cascades
-