RGS6 Antikörper (N-Term)

Produktnummer ABIN634402

Produktdetails anti-RGS6 Antikörper

Target: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RGS6 antibody was raised against the N terminal of RGS6

Aufreinigung: Affinity purified

Immunogen: RGS6 antibody was raised using the N terminal of RGS6 corresponding to a region with amino acids AQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS6 Blocking Peptide, catalog no. 33R-1447, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS6

Target: RGS6 (Regulator of G-Protein Signaling 6 (RGS6))

Andere Bezeichnung: RGS6 (RGS6 Produkte)

Synonyme: RGS6 antikoerper, DKFZp459O0734 antikoerper, GAP antikoerper, hm:zeh0300 antikoerper, si:ch211-268e23.2 antikoerper, regulator of G protein signaling 6 antikoerper, regulator of G-protein signaling 6 antikoerper, regulator of G-protein signaling 6 S homeolog antikoerper, RGS6 antikoerper, Rgs6 antikoerper, rgs6.S antikoerper, rgs6 antikoerper

Hintergrund: Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling