RGS6 Antikörper (C-Term)
-
- Target Alle RGS6 Antikörper anzeigen
- RGS6 (Regulator of G-Protein Signaling 6 (RGS6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RGS6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RGS6 antibody was raised against the C terminal of RGS6
- Aufreinigung
- Affinity purified
- Immunogen
- RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY
- Top Product
- Discover our top product RGS6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RGS6 Blocking Peptide, catalog no. 33R-8297, is also available for use as a blocking control in assays to test for specificity of this RGS6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
RGS6 Mediates Effects of Voluntary Running on Adult Hippocampal Neurogenesis." in: Cell reports, Vol. 32, Issue 5, pp. 107997, (2020) (PubMed).
: "
-
RGS6 Mediates Effects of Voluntary Running on Adult Hippocampal Neurogenesis." in: Cell reports, Vol. 32, Issue 5, pp. 107997, (2020) (PubMed).
-
- Target
- RGS6 (Regulator of G-Protein Signaling 6 (RGS6))
- Andere Bezeichnung
- RGS6 (RGS6 Produkte)
- Hintergrund
- Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-