MKNK2 Antikörper (N-Term)

Produktnummer ABIN634405

Produktdetails anti-MKNK2 Antikörper

Target: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MKNK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MKNK2 antibody was raised against the N terminal of MKNK2

Aufreinigung: Affinity purified

Immunogen: MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MKNK2 Blocking Peptide, catalog no. 33R-8351, is also available for use as a blocking control in assays to test for specificity of this MKNK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKNK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MKNK2

Target: MKNK2 (MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2))

Andere Bezeichnung: MKNK2 (MKNK2 Produkte)

Synonyme: GPRK7 antikoerper, MNK2 antikoerper, gprk7 antikoerper, mnk2 antikoerper, 2010016G11Rik antikoerper, Gprk7 antikoerper, Mnk2 antikoerper, mknk2 antikoerper, wu:fb37e05 antikoerper, wz5090 antikoerper, fi34c11 antikoerper, wu:fi34c11 antikoerper, wu:fi41e12 antikoerper, zgc:55587 antikoerper, MAP kinase interacting serine/threonine kinase 2 antikoerper, MAP kinase-interacting serine/threonine kinase 2 antikoerper, MAP kinase interacting serine/threonine kinase 2b antikoerper, MAP kinase interacting serine/threonine kinase 2 L homeolog antikoerper, MAP kinase interacting serine/threonine kinase 2a antikoerper, MKNK2 antikoerper, mknk2 antikoerper, Mknk2 antikoerper, mknk2b antikoerper, mknk2.L antikoerper, mknk2a antikoerper

Hintergrund: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: MAPK Signalweg