RGS4 Antikörper (C-Term)

Produktnummer ABIN634407

Produktdetails anti-RGS4 Antikörper

Target: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RGS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RGS4 antibody was raised against the C terminal of RGS4

Aufreinigung: Affinity purified

Immunogen: RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RGS4 Blocking Peptide, catalog no. 33R-2276, is also available for use as a blocking control in assays to test for specificity of this RGS4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RGS4

Target: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Andere Bezeichnung: RGS4 (RGS4 Produkte)

Synonyme: RGP4 antikoerper, SCZD9 antikoerper, AA004315 antikoerper, AA597169 antikoerper, ESTM48 antikoerper, ESTM50 antikoerper, regulator of G protein signaling 4 antikoerper, regulator of G-protein signaling 4 antikoerper, RGS4 antikoerper, Rgs4 antikoerper

Hintergrund: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling