DUSP10 Antikörper (N-Term)
-
- Target Alle DUSP10 Antikörper anzeigen
- DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DUSP10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DUSP10 antibody was raised against the N terminal of DUSP10
- Aufreinigung
- Affinity purified
- Immunogen
- DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE
- Top Product
- Discover our top product DUSP10 Primärantikörper
-
anti-Dual Specificity Phosphatase 10 (DUSP10) (AA 1-140) antibody
DUSP10 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (C-Term) antibodyDUSP10 Reaktivität: Human WB, IHC (p), ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (Internal Region) antibodyDUSP10 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (AA 1-30), (N-Term) antibodyDUSP10 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB5879 unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (AA 204-232) antibodyDUSP10 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB41917 unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (C-Term) antibodyDUSP10 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (AA 1-300) antibodyDUSP10 Reaktivität: Human WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (C-Term) antibodyVerified DUSP10 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (N-Term) antibodyDUSP10 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen, Zebrafisch (Danio rerio), Fledermaus, Affe, Huhn, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dual Specificity Phosphatase 10 (DUSP10) (N-Term) antibodyDUSP10 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DUSP10 Blocking Peptide, catalog no. 33R-6340, is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))
- Andere Bezeichnung
- DUSP10 (DUSP10 Produkte)
- Synonyme
- DUSP10 antikoerper, MKP-5 antikoerper, MKP5 antikoerper, 2610306G15Rik antikoerper, AI158871 antikoerper, Mkp-5 antikoerper, Mkp5 antikoerper, dual specificity phosphatase 10 antikoerper, DUSP10 antikoerper, Dusp10 antikoerper
- Hintergrund
- Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.
- Molekulargewicht
- 16 kDa (MW of target protein)
-
