ASB8 Antikörper (N-Term)
-
- Target Alle ASB8 Antikörper anzeigen
- ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASB8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ASB8 antibody was raised against the N terminal of ASB8
- Aufreinigung
- Affinity purified
- Immunogen
- ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT
- Top Product
- Discover our top product ASB8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASB8 Blocking Peptide, catalog no. 33R-6512, is also available for use as a blocking control in assays to test for specificity of this ASB8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))
- Andere Bezeichnung
- ASB8 (ASB8 Produkte)
- Hintergrund
- ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
- Molekulargewicht
- 32 kDa (MW of target protein)
-