ASB8 Antikörper (N-Term)

Produktnummer ABIN634410

Produktdetails anti-ASB8 Antikörper

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASB8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASB8 antibody was raised against the N terminal of ASB8

Aufreinigung: Affinity purified

Immunogen: ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASB8 Blocking Peptide, catalog no. 33R-6512, is also available for use as a blocking control in assays to test for specificity of this ASB8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASB8

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Andere Bezeichnung: ASB8 (ASB8 Produkte)

Synonyme: wu:fd16d08 antikoerper, zgc:64033 antikoerper, 4930539L19Rik antikoerper, AI788835 antikoerper, C430011H06Rik antikoerper, ankyrin repeat and SOCS box containing 8 antikoerper, ankyrin repeat and SOCS box-containing 8 antikoerper, ASB8 antikoerper, asb8 antikoerper, Asb8 antikoerper

Hintergrund: ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molekulargewicht: 32 kDa (MW of target protein)