Pleckstrin Antikörper (N-Term)

Produktnummer ABIN634412

Produktdetails anti-Pleckstrin Antikörper

Target: Pleckstrin (PLEK)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pleckstrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLEK antibody was raised against the N terminal of PLEK

Aufreinigung: Affinity purified

Immunogen: PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLEK Blocking Peptide, catalog no. 33R-5943, is also available for use as a blocking control in assays to test for specificity of this PLEK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pleckstrin

Target: Pleckstrin (PLEK)

Andere Bezeichnung: PLEK (PLEK Produkte)

Synonyme: MGC69065 antikoerper, PLEK antikoerper, P47 antikoerper, 2010300B13Rik antikoerper, pleckstrin L homeolog antikoerper, pleckstrin antikoerper, plek.L antikoerper, PLEK antikoerper, Plek antikoerper

Hintergrund: PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process