RHOBTB1 Antikörper (Middle Region)

Produktnummer ABIN634415

Produktdetails anti-RHOBTB1 Antikörper

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOBTB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RHOBTB1 antibody was raised against the middle region of RHOBTB1

Aufreinigung: Affinity purified

Immunogen: RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOBTB1 Blocking Peptide, catalog no. 33R-2087, is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOBTB1

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Andere Bezeichnung: RHOBTB1 (RHOBTB1 Produkte)

Synonyme: 1700008H16Rik antikoerper, 3110048G13Rik antikoerper, AI173445 antikoerper, AI573858 antikoerper, AV350930 antikoerper, Rho related BTB domain containing 1 antikoerper, Rho-related BTB domain containing 1 antikoerper, Rho related BTB domain containing 1 S homeolog antikoerper, RHOBTB1 antikoerper, rhobtb1 antikoerper, rhobtb1.S antikoerper, Rhobtb1 antikoerper

Hintergrund: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

Molekulargewicht: 77 kDa (MW of target protein)