RHOBTB1 Antikörper (Middle Region)
-
- Target Alle RHOBTB1 Antikörper anzeigen
- RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RHOBTB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- RHOBTB1 antibody was raised against the middle region of RHOBTB1
- Aufreinigung
- Affinity purified
- Immunogen
- RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN
- Top Product
- Discover our top product RHOBTB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RHOBTB1 Blocking Peptide, catalog no. 33R-2087, is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))
- Andere Bezeichnung
- RHOBTB1 (RHOBTB1 Produkte)
- Hintergrund
- RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.
- Molekulargewicht
- 77 kDa (MW of target protein)
-