PKC gamma Antikörper (N-Term)
-
- Target Alle PKC gamma (PRKCG) Antikörper anzeigen
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PKC gamma Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKCG antibody was raised against the N terminal of PRKCG
- Aufreinigung
- Affinity purified
- Immunogen
- PRKCG antibody was raised using the N terminal of PRKCG corresponding to a region with amino acids FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
- Top Product
- Discover our top product PRKCG Primärantikörper
-
anti-Protein Kinase C, gamma (PRKCG) (pThr514) antibody
PRKCG Reaktivität: Human, Maus WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 305-336), (C-Term) antibodyPRKCG Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB1007 unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 260-351) antibodyPRKCG Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (Internal Region) antibodyPRKCG Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (Thr655) antibodyPRKCG Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 1-314) antibodyPRKCG Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 71-120) antibodyPRKCG Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Hund, Meerschweinchen, Pferd, Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 539-588) antibodyPRKCG Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Hund, Meerschweinchen, Pferd, Affe, Zebrafisch (Danio rerio), Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (N-Term) antibodyPRKCG Reaktivität: Human WB, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Kinase C, gamma (PRKCG) (AA 351-614) antibodyPRKCG Reaktivität: Ratte WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKCG Blocking Peptide, catalog no. 33R-3124, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
- Andere Bezeichnung
- PRKCG (PRKCG Produkte)
- Hintergrund
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Molekulargewicht
- 78 kDa (MW of target protein)
- Pathways
- WNT Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling
-
