PKC gamma Antikörper (N-Term)
-
- Target Alle PKC gamma (PRKCG) Antikörper anzeigen
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PKC gamma Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKCG antibody was raised against the N terminal of PRKCG
- Aufreinigung
- Affinity purified
- Immunogen
- PRKCG antibody was raised using the N terminal of PRKCG corresponding to a region with amino acids FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
- Top Product
- Discover our top product PRKCG Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKCG Blocking Peptide, catalog no. 33R-3124, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))
- Andere Bezeichnung
- PRKCG (PRKCG Produkte)
- Synonyme
- PRKCG antikoerper, PKC-gamma antikoerper, PKCC antikoerper, PKCG antikoerper, SCA14 antikoerper, PKCgamma antikoerper, Pkcc antikoerper, Prkcc antikoerper, PKC antikoerper, PKCI antikoerper, Prkc antikoerper, RATPKCI antikoerper, protein kinase C gamma antikoerper, protein kinase C, gamma antikoerper, protein kinase C gamma type antikoerper, PRKCG antikoerper, Prkcg antikoerper, LOC484316 antikoerper
- Hintergrund
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Molekulargewicht
- 78 kDa (MW of target protein)
- Pathways
- WNT Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling
-