PLCD1 Antikörper (N-Term)
-
- Target Alle PLCD1 Antikörper anzeigen
- PLCD1 (phospholipase C, delta 1 (PLCD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLCD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLCD1 antibody was raised against the N terminal of PLCD1
- Aufreinigung
- Affinity purified
- Immunogen
- PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
- Top Product
- Discover our top product PLCD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLCD1 (phospholipase C, delta 1 (PLCD1))
- Andere Bezeichnung
- PLCD1 (PLCD1 Produkte)
- Hintergrund
- Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
- Molekulargewicht
- 86 kDa (MW of target protein)
- Pathways
- WNT Signalweg, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process
-