TP53TG5 Antikörper (N-Term)

Produktnummer ABIN634430

Produktdetails anti-TP53TG5 Antikörper

Target: TP53TG5 (TP53 Target 5 (TP53TG5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TP53TG5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C20 ORF10 antibody was raised against the N terminal Of C20 rf10

Aufreinigung: Affinity purified

Immunogen: C20 ORF10 antibody was raised using the N terminal Of C20 rf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C20ORF10 Blocking Peptide, catalog no. 33R-8050, is also available for use as a blocking control in assays to test for specificity of this C20ORF10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TP53TG5

Target: TP53TG5 (TP53 Target 5 (TP53TG5))

Andere Bezeichnung: C20ORF10 (TP53TG5 Produkte)

Synonyme: TP53TG5 antikoerper, C20orf10 antikoerper, CLG01 antikoerper, TP53 target 5 antikoerper, TP53TG5 antikoerper

Hintergrund: C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.

Molekulargewicht: 32 kDa (MW of target protein)