RABL4 Antikörper (C-Term)

Produktnummer ABIN634436

Produktdetails anti-RABL4 Antikörper

Target: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RABL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RABL4 antibody was raised against the C terminal of RABL4

Aufreinigung: Affinity purified

Immunogen: RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RABL4 Blocking Peptide, catalog no. 33R-7831, is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RABL4

Target: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Andere Bezeichnung: RABL4 (IFT27 Produkte)

Synonyme: 2600013G09Rik antikoerper, Rabl4 antikoerper, RABL4 antikoerper, RAYL antikoerper, intraflagellar transport 27 antikoerper, Ift27 antikoerper, IFT27 antikoerper

Hintergrund: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Hedgehog Signalweg