RABL4 Antikörper (C-Term)
-
- Target Alle RABL4 (IFT27) Antikörper anzeigen
- RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RABL4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RABL4 antibody was raised against the C terminal of RABL4
- Aufreinigung
- Affinity purified
- Immunogen
- RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
- Top Product
- Discover our top product IFT27 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RABL4 Blocking Peptide, catalog no. 33R-7831, is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABL4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))
- Andere Bezeichnung
- RABL4 (IFT27 Produkte)
- Hintergrund
- RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-