RAB38 Antikörper (N-Term)
-
- Target Alle RAB38 Antikörper anzeigen
- RAB38 (RAB38, Member RAS Oncogene Family (RAB38))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAB38 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAB38 antibody was raised against the N terminal of RAB38
- Aufreinigung
- Affinity purified
- Immunogen
- RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV
- Top Product
- Discover our top product RAB38 Primärantikörper
-
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 115-211) antibody
RAB38 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 7F1 unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) antibodyRAB38 Reaktivität: Human, Maus ELISA, WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (Internal Region) antibodyRAB38 Reaktivität: Human, Maus, Ratte ELISA, WB, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) antibodyRAB38 Reaktivität: Human, Maus ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 115-211) antibodyRAB38 Reaktivität: Human ELISA, WB Wirt: Maus Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (C-Term) antibodyRAB38 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Hamster, Affe, Schaf, Schwein, Ziege, Esel, Huhn, Cat, Avian WB Wirt: Ziege Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 1-211) antibodyRAB38 Reaktivität: Human IP Wirt: Kaninchen Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 1-211) antibodyRAB38 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 1-211) antibodyRAB38 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 1H8 unconjugated
anti-RAB38, Member RAS Oncogene Family (RAB38) (AA 92-211) antibodyRAB38 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAB38 Blocking Peptide, catalog no. 33R-6318, is also available for use as a blocking control in assays to test for specificity of this RAB38 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB38 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB38 (RAB38, Member RAS Oncogene Family (RAB38))
- Andere Bezeichnung
- RAB38 (RAB38 Produkte)
- Synonyme
- RAB38 antikoerper, rab38 antikoerper, 2310011F14Rik antikoerper, AU043391 antikoerper, cht antikoerper, NY-MEL-1 antikoerper, rrGTPbp antikoerper, R antikoerper, Ruby antikoerper, RAB38, member RAS oncogene family antikoerper, RAB38a, member RAS oncogene family antikoerper, RAB38, member RAS oncogene family S homeolog antikoerper, RAB38 antikoerper, rab38a antikoerper, rab38.S antikoerper, Rab38 antikoerper
- Hintergrund
- RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.
- Molekulargewicht
- 24 kDa (MW of target protein)
-
