TBL3 Antikörper
-
- Target Alle TBL3 Antikörper anzeigen
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TBL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TBL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAETAAGVGRFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCGTRVNIL
- Top Product
- Discover our top product TBL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TBL3 Blocking Peptide, catalog no. 33R-5646, is also available for use as a blocking control in assays to test for specificity of this TBL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TBL3 (Transducin (Beta)-Like 3 (TBL3))
- Andere Bezeichnung
- TBL3 (TBL3 Produkte)
- Synonyme
- MGC69179 antikoerper, zgc:101778 antikoerper, AmCG7589 antikoerper, GB11903 antikoerper, SAZD antikoerper, UTP13 antikoerper, 9430070M15Rik antikoerper, transducin (beta)-like 3 L homeolog antikoerper, transducin beta like 3 antikoerper, transducin (beta)-like 3 antikoerper, transducin beta-like protein 3 antikoerper, tbl3.L antikoerper, TBL3 antikoerper, tbl3 antikoerper, LOC724596 antikoerper, Tbl3 antikoerper
- Hintergrund
- The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function.
- Molekulargewicht
- 89 kDa (MW of target protein)
-