ACOT11 Antikörper (Middle Region)
-
- Target Alle ACOT11 Antikörper anzeigen
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACOT11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACOT11 antibody was raised against the middle region of ACOT11
- Aufreinigung
- Affinity purified
- Immunogen
- ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE
- Top Product
- Discover our top product ACOT11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACOT11 Blocking Peptide, catalog no. 33R-10276, is also available for use as a blocking control in assays to test for specificity of this ACOT11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACOT11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACOT11 (Acyl-CoA Thioesterase 11 (ACOT11))
- Andere Bezeichnung
- ACOT11 (ACOT11 Produkte)
- Synonyme
- BFIT antikoerper, STARD14 antikoerper, THEA antikoerper, THEM1 antikoerper, 1110020M10Rik antikoerper, 2010309H15Rik antikoerper, AW060409 antikoerper, BFIT1 antikoerper, Thea antikoerper, Them1 antikoerper, mKIAA0707 antikoerper, acot11 antikoerper, zgc:113011 antikoerper, ACOT11 antikoerper, DKFZp469E1816 antikoerper, acyl-CoA thioesterase 11 antikoerper, acyl-CoA thioesterase 11a antikoerper, acyl-CoA thioesterase 11 L homeolog antikoerper, ACOT11 antikoerper, Acot11 antikoerper, acot11a antikoerper, acot11.L antikoerper, acot11 antikoerper
- Hintergrund
- ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.
- Molekulargewicht
- 68 kDa (MW of target protein)
-