RAB5B Antikörper (N-Term)

Produktnummer ABIN634446

Produktdetails anti-RAB5B Antikörper

Target: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB5 B antibody was raised against the N terminal of RAB5

Aufreinigung: Affinity purified

Immunogen: RAB5 B antibody was raised using the N terminal of RAB5 corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB5B Blocking Peptide, catalog no. 33R-6565, is also available for use as a blocking control in assays to test for specificity of this RAB5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB5B

Target: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Andere Bezeichnung: RAB5B (RAB5B Produkte)

Synonyme: zgc:76978 antikoerper, C030027M18Rik antikoerper, RAB5B, member RAS oncogene family antikoerper, RAB5B, member RAS oncogene family L homeolog antikoerper, rab5b antikoerper, LOC613071 antikoerper, RAB5B antikoerper, Rab5b antikoerper, rab5b.L antikoerper

Hintergrund: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Molekulargewicht: 24 kDa (MW of target protein)