Adenylate Kinase 3 Antikörper (N-Term)

Produktnummer ABIN634447

Produktdetails anti-Adenylate Kinase 3 Antikörper

Target: Adenylate Kinase 3 (AK3)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AK3 antibody was raised against the N terminal of AK3

Aufreinigung: Affinity purified

Immunogen: AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AK3 Blocking Peptide, catalog no. 33R-6011, is also available for use as a blocking control in assays to test for specificity of this AK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Adenylate Kinase 3

Target: Adenylate Kinase 3 (AK3)

Andere Bezeichnung: AK3 (AK3 Produkte)

Synonyme: AK3L1 antikoerper, AK6 antikoerper, AKL3L antikoerper, AKL3L1 antikoerper, FIX antikoerper, AK4 antikoerper, AA407498 antikoerper, AI506714 antikoerper, AK-3 antikoerper, Ak3l antikoerper, Ak3l1 antikoerper, Akl3l antikoerper, ak3l1 antikoerper, sb:cb845 antikoerper, zgc:64135 antikoerper, id:ibd3034 antikoerper, wu:fa02c11 antikoerper, wu:fc20h08 antikoerper, AK3 antikoerper, CG6612 antikoerper, DAK3 antikoerper, Dak3 antikoerper, Dmel\\CG6612 antikoerper, bs12h03.y1 antikoerper, MGC114646 antikoerper, ak6 antikoerper, adenylate kinase 3 antikoerper, Adenylate kinase 3 antikoerper, adenylate kinase 3 L homeolog antikoerper, AK3 antikoerper, Ak3 antikoerper, ak3 antikoerper, Adk3 antikoerper, ak3.L antikoerper, ADK3 antikoerper

Hintergrund: The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process