ARF1 Antikörper (Middle Region)
-
- Target Alle ARF1 Antikörper anzeigen
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARF1 antibody was raised against the middle region of ARF1
- Aufreinigung
- Affinity purified
- Immunogen
- ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
- Top Product
- Discover our top product ARF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
- Andere Bezeichnung
- ARF1 (ARF1 Produkte)
- Synonyme
- wu:fb33e02 antikoerper, wu:fb78h01 antikoerper, arf2 antikoerper, arf-1 antikoerper, MGC52573 antikoerper, ADP-RIBOSYLATION FACTOR antikoerper, ADP-RIBOSYLATION FACTOR 1A antikoerper, ADP-ribosylation factor 1 antikoerper, ATARF antikoerper, ATARF1 antikoerper, ATARFA1A antikoerper, F28C11.12 antikoerper, ARF1 antikoerper, arf1 antikoerper, ADP ribosylation factor 1 antikoerper, ADP-ribosylation factor 1 antikoerper, ADP ribosylation factor 1 L homeolog antikoerper, ADP ribosylation factor 5 L homeolog antikoerper, ADP ribosylation factor 1 pseudogene antikoerper, adp-ribosylation factor 1 antikoerper, ARF1 antikoerper, Arf1 antikoerper, arf1 antikoerper, arf1.L antikoerper, arf5.L antikoerper, NCU08340 antikoerper, TRIADDRAFT_63238 antikoerper, PAAG_08805 antikoerper, LOC100280562 antikoerper, LOC100280918 antikoerper, LOC474591 antikoerper, CLUG_01013 antikoerper
- Hintergrund
- ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Inositol Metabolic Process
-