NKIRAS1 Antikörper (N-Term)
-
- Target Alle NKIRAS1 Antikörper anzeigen
- NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NKIRAS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NKIRAS1 antibody was raised against the N terminal of NKIRAS1
- Aufreinigung
- Affinity purified
- Immunogen
- NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
- Top Product
- Discover our top product NKIRAS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NKIRAS1 Blocking Peptide, catalog no. 33R-1680, is also available for use as a blocking control in assays to test for specificity of this NKIRAS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))
- Andere Bezeichnung
- NKIRAS1 (NKIRAS1 Produkte)
- Hintergrund
- NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
- Molekulargewicht
- 22 kDa (MW of target protein)
-