NKIRAS1 Antikörper (N-Term)

Produktnummer ABIN634451

Produktdetails anti-NKIRAS1 Antikörper

Target: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NKIRAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NKIRAS1 antibody was raised against the N terminal of NKIRAS1

Aufreinigung: Affinity purified

Immunogen: NKIRAS1 antibody was raised using the N terminal of NKIRAS1 corresponding to a region with amino acids CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NKIRAS1 Blocking Peptide, catalog no. 33R-1680, is also available for use as a blocking control in assays to test for specificity of this NKIRAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NKIRAS1

Target: NKIRAS1 (NFKB Inhibitor Interacting Ras-Like 1 (NKIRAS1))

Andere Bezeichnung: NKIRAS1 (NKIRAS1 Produkte)

Synonyme: NKIRAS1 antikoerper, KBRAS1 antikoerper, kappaB-Ras1 antikoerper, zgc:92823 antikoerper, kbras1 antikoerper, 2400004O09Rik antikoerper, NFKB inhibitor interacting Ras like 1 antikoerper, NFKB inhibitor interacting Ras-like 1 antikoerper, NFKB inhibitor interacting Ras-like 1 S homeolog antikoerper, NFKB inhibitor interacting Ras-like protein 1 antikoerper, NKIRAS1 antikoerper, nkiras1 antikoerper, nkiras1.S antikoerper, Nkiras1 antikoerper

Hintergrund: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.

Molekulargewicht: 22 kDa (MW of target protein)