ASB6 Antikörper (Middle Region)
-
- Target Alle ASB6 Antikörper anzeigen
- ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ASB6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ASB6 antibody was raised against the middle region of ASB6
- Aufreinigung
- Affinity purified
- Immunogen
- ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV
- Top Product
- Discover our top product ASB6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ASB6 Blocking Peptide, catalog no. 33R-5090, is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))
- Andere Bezeichnung
- ASB6 (ASB6 Produkte)
- Synonyme
- zgc:110231 antikoerper, 2510004M11Rik antikoerper, AA409356 antikoerper, ankyrin repeat and SOCS box containing 6 antikoerper, ankyrin repeat and SOCS box containing 6 S homeolog antikoerper, ankyrin repeat and SOCS box-containing 6 antikoerper, asb6 antikoerper, asb6.S antikoerper, ASB6 antikoerper, Asb6 antikoerper
- Hintergrund
- ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.
- Molekulargewicht
- 46 kDa (MW of target protein)
-