RBM9 Antikörper (Middle Region)
-
- Target Alle RBM9 Antikörper anzeigen
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM9 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM9 antibody was raised against the middle region of RBM9
- Aufreinigung
- Affinity purified
- Immunogen
- RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
- Top Product
- Discover our top product RBM9 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM9 Blocking Peptide, catalog no. 33R-7280, is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
- Andere Bezeichnung
- RBM9 (RBM9 Produkte)
- Synonyme
- rta antikoerper, fox2 antikoerper, xrbm9 antikoerper, hrnbp2 antikoerper, MGC79813 antikoerper, RBM9 antikoerper, rbm9a antikoerper, FOX2 antikoerper, Fox-2 antikoerper, HNRBP2 antikoerper, HRNBP2 antikoerper, RTA antikoerper, dJ106I20.3 antikoerper, fxh antikoerper, 2810460A15Rik antikoerper, AA407676 antikoerper, AI118529 antikoerper, Fbm2 antikoerper, Fxh antikoerper, Hrnbp2 antikoerper, Rbm9 antikoerper, rbm9 antikoerper, zgc:85694 antikoerper, fox-2 antikoerper, hnrbp2 antikoerper, rbfox2 antikoerper, rbm9-b antikoerper, rbm9b antikoerper, RNA binding protein, fox-1 homolog 2 antikoerper, RNA binding fox-1 homolog 2 antikoerper, RNA binding fox-1 homolog 2 L homeolog antikoerper, RNA binding protein, fox-1 homolog (C. elegans) 2 antikoerper, RNA binding fox-1 homolog 2 S homeolog antikoerper, RBFOX2 antikoerper, rbfox2 antikoerper, rbfox2.L antikoerper, Rbfox2 antikoerper, rbfox2.S antikoerper
- Hintergrund
- RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development
-