AIMP1 Antikörper

Produktnummer ABIN634468

Produktdetails anti-AIMP1 Antikörper

Target: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AIMP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCYE1 Blocking Peptide, catalog no. 33R-5153, is also available for use as a blocking control in assays to test for specificity of this SCYE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AIMP1

Target: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Andere Bezeichnung: SCYE1 (AIMP1 Produkte)

Synonyme: EMAP2 antikoerper, EMAPII antikoerper, HLD3 antikoerper, SCYE1 antikoerper, p43 antikoerper, wu:fa95a05 antikoerper, zgc:154081 antikoerper, AIMP1 antikoerper, 9830137A06Rik antikoerper, AIMP1/p43 antikoerper, Emap2 antikoerper, Scye1 antikoerper, scye1 antikoerper, aminoacyl tRNA synthetase complex interacting multifunctional protein 1 antikoerper, aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 antikoerper, aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 S homeolog antikoerper, AIMP1 antikoerper, aimp1 antikoerper, Aimp1 antikoerper, aimp1.S antikoerper

Hintergrund: SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.

Molekulargewicht: 34 kDa (MW of target protein)