CFP Antikörper (N-Term)

Produktnummer ABIN634481

Produktdetails anti-CFP Antikörper

Target: CFP (Complement Factor P (CFP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CFP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CFP antibody was raised against the N terminal of CFP

Aufreinigung: Affinity purified

Immunogen: CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CFP Blocking Peptide, catalog no. 33R-7790, is also available for use as a blocking control in assays to test for specificity of this CFP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CFP

Target: CFP (Complement Factor P (CFP))

Andere Bezeichnung: CFP (CFP Produkte)

Synonyme: BFD antikoerper, PFC antikoerper, PFD antikoerper, PROPERDIN antikoerper, BCFG antikoerper, Pfc antikoerper, Properdin antikoerper, complement factor properdin antikoerper, CFP antikoerper, Cfp antikoerper

Hintergrund: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Komplementsystem