IL-15 Antikörper (N-Term)
-
- Target Alle IL-15 (IL15) Antikörper anzeigen
- IL-15 (IL15) (Interleukin 15 (IL15))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL-15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL15 antibody was raised against the N terminal of IL15
- Aufreinigung
- Affinity purified
- Immunogen
- IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
- Top Product
- Discover our top product IL15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL15 Blocking Peptide, catalog no. 33R-7982, is also available for use as a blocking control in assays to test for specificity of this IL15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-15 (IL15) (Interleukin 15 (IL15))
- Andere Bezeichnung
- IL15 (IL15 Produkte)
- Synonyme
- IL15 antikoerper, AI503618 antikoerper, IL-15 antikoerper, interleukin 15 antikoerper, IL15 antikoerper, Il15 antikoerper
- Hintergrund
- IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.
- Molekulargewicht
- 13 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Glycosaminoglycan Metabolic Process
-