BPIFA1 Antikörper (Middle Region)

Produktnummer ABIN634486

Produktdetails anti-BPIFA1 Antikörper

Target: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BPIFA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLUNC antibody was raised against the middle region of PLUNC

Aufreinigung: Affinity purified

Immunogen: PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLUNC Blocking Peptide, catalog no. 33R-3412, is also available for use as a blocking control in assays to test for specificity of this PLUNC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLUNC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BPIFA1

Target: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Andere Bezeichnung: PLUNC (BPIFA1 Produkte)

Synonyme: LUNX antikoerper, NASG antikoerper, PLUNC antikoerper, SPLUNC1 antikoerper, SPURT antikoerper, bA49G10.5 antikoerper, Plunc antikoerper, BPI fold containing family A member 1 antikoerper, BPI fold containing family A, member 1 antikoerper, BPIFA1 antikoerper, Bpifa1 antikoerper

Hintergrund: PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.

Molekulargewicht: 28 kDa (MW of target protein)