Lipocalin 1 Antikörper
-
- Target Alle Lipocalin 1 (LCN1) Antikörper anzeigen
- Lipocalin 1 (LCN1)
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Lipocalin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
- Top Product
- Discover our top product LCN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Lipocalin 1 Blocking Peptide, catalog no. 33R-4140, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lipocalin 1 (LCN1)
- Andere Bezeichnung
- Lipocalin 1 (LCN1 Produkte)
- Synonyme
- PMFA antikoerper, TLC antikoerper, TP antikoerper, VEGP antikoerper, VEG antikoerper, lipocalin 1 antikoerper, odorant binding protein 2B antikoerper, lipocalin-1 antikoerper, LCN1 antikoerper, OBP2B antikoerper, Lcn1 antikoerper, LOC103346758 antikoerper
- Hintergrund
- LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.
- Molekulargewicht
- 17 kDa (MW of target protein)
-