C4BPB Antikörper (N-Term)

Produktnummer ABIN634490

Produktdetails anti-C4BPB Antikörper

Target: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C4BPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: C4 BPB antibody was raised against the N terminal of C4 PB

Aufreinigung: Affinity purified

Immunogen: C4 BPB antibody was raised using the N terminal of C4 PB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C4BPB Blocking Peptide, catalog no. 33R-1652, is also available for use as a blocking control in assays to test for specificity of this C4BPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C4BPB

Target: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Andere Bezeichnung: C4BPB (C4BPB Produkte)

Synonyme: C4BPB antikoerper, C4BP antikoerper, C4bp-ps1 antikoerper, complement component 4 binding protein beta antikoerper, complement component 4 binding protein, beta antikoerper, C4BPB antikoerper, C4bpb antikoerper

Hintergrund: C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Komplementsystem