MASP2 Antikörper (N-Term)

Produktnummer ABIN634492

Produktdetails anti-MASP2 Antikörper

Target: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MASP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MASP2 antibody was raised against the N terminal of MASP2

Aufreinigung: Affinity purified

Immunogen: MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MASP2 Blocking Peptide, catalog no. 33R-3017, is also available for use as a blocking control in assays to test for specificity of this MASP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MASP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MASP2

Target: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Andere Bezeichnung: MASP2 (MASP2 Produkte)

Synonyme: MAP19 antikoerper, MASP-2 antikoerper, MASP1P1 antikoerper, sMAP antikoerper, MAp19 antikoerper, mannan binding lectin serine peptidase 2 antikoerper, mannan-binding lectin serine peptidase 2 antikoerper, MASP2 antikoerper, Masp2 antikoerper

Hintergrund: The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Komplementsystem