CHIA Antikörper (N-Term)

Produktnummer ABIN634493

Produktdetails anti-CHIA Antikörper

Target: CHIA (Chitinase, Acidic (CHIA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHIA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHIA antibody was raised against the N terminal of CHIA

Aufreinigung: Affinity purified

Immunogen: CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHIA Blocking Peptide, catalog no. 33R-6610, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHIA

Target: CHIA (Chitinase, Acidic (CHIA))

Andere Bezeichnung: CHIA (CHIA Produkte)

Synonyme: chia-a antikoerper, AMCASE antikoerper, CHIT2 antikoerper, TSA1902 antikoerper, 2200003E03Rik antikoerper, AMCase antikoerper, YNL antikoerper, CHIA antikoerper, chioIIa antikoerper, fa55g10 antikoerper, wu:fa55g10 antikoerper, zgc:63792 antikoerper, acidic mammalian chitinase antikoerper, chitinase, acidic antikoerper, chitinase, acidic S homeolog antikoerper, chitinase-M31, acidic antikoerper, chitinase, acidic 1 antikoerper, chitinase, acidic.4 antikoerper, LOC703284 antikoerper, CHIA antikoerper, LOC100600050 antikoerper, chia.S antikoerper, CHIA-M31 antikoerper, Chia1 antikoerper, Chia antikoerper, chia.4 antikoerper

Hintergrund: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

Molekulargewicht: 40 kDa (MW of target protein)