CHIA Antikörper (Middle Region)
-
- Target Alle CHIA Antikörper anzeigen
- CHIA (Chitinase, Acidic (CHIA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHIA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHIA antibody was raised against the middle region of CHIA
- Aufreinigung
- Affinity purified
- Immunogen
- CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP
- Top Product
- Discover our top product CHIA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHIA Blocking Peptide, catalog no. 33R-3598, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHIA (Chitinase, Acidic (CHIA))
- Andere Bezeichnung
- CHIA (CHIA Produkte)
- Synonyme
- chia-a antikoerper, AMCASE antikoerper, CHIT2 antikoerper, TSA1902 antikoerper, 2200003E03Rik antikoerper, AMCase antikoerper, YNL antikoerper, CHIA antikoerper, chioIIa antikoerper, fa55g10 antikoerper, wu:fa55g10 antikoerper, zgc:63792 antikoerper, acidic mammalian chitinase antikoerper, chitinase, acidic antikoerper, chitinase, acidic S homeolog antikoerper, chitinase-M31, acidic antikoerper, chitinase, acidic 1 antikoerper, chitinase, acidic.4 antikoerper, LOC703284 antikoerper, CHIA antikoerper, LOC100600050 antikoerper, chia.S antikoerper, CHIA-M31 antikoerper, Chia1 antikoerper, Chia antikoerper, chia.4 antikoerper
- Hintergrund
- CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.
- Molekulargewicht
- 40 kDa (MW of target protein)
-