CD40 Antikörper (N-Term)
-
- Target Alle CD40 Antikörper anzeigen
- CD40
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CD40 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CD40 antibody was raised against the N terminal of CD40
- Aufreinigung
- Affinity purified
- Immunogen
- CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
- Top Product
- Discover our top product CD40 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CD40 Blocking Peptide, catalog no. 33R-8706, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD40
- Andere Bezeichnung
- CD40 (CD40 Produkte)
- Synonyme
- Bp50 antikoerper, CDW40 antikoerper, TNFRSF5 antikoerper, p50 antikoerper, AI326936 antikoerper, GP39 antikoerper, HIGM1 antikoerper, IGM antikoerper, IMD3 antikoerper, T-BAM antikoerper, TRAP antikoerper, Tnfrsf5 antikoerper, TNFSF5 antikoerper, CD40 molecule antikoerper, CD40 antigen antikoerper, CD40 antikoerper, Cd40 antikoerper
- Hintergrund
- CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints
-