Perforin 1 Antikörper
-
- Target Alle Perforin 1 (PRF1) Antikörper anzeigen
- Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Perforin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Perforin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR
- Top Product
- Discover our top product PRF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Perforin 1 Blocking Peptide, catalog no. 33R-8899, is also available for use as a blocking control in assays to test for specificity of this Perforin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))
- Andere Bezeichnung
- Perforin 1 (PRF1 Produkte)
- Synonyme
- FLH2 antikoerper, HPLH2 antikoerper, P1 antikoerper, PFN1 antikoerper, PFP antikoerper, PRF1 antikoerper, Pfn antikoerper, Pfp antikoerper, Prf-1 antikoerper, Cyta antikoerper, RATCYTA antikoerper, LOC443187 antikoerper, perforin antikoerper, prf1 antikoerper, cytolysin antikoerper, perforin-1 antikoerper, perforin-1-like antikoerper, perforin 1 antikoerper, perforin 1 (pore forming protein) antikoerper, perforin antikoerper, perforin 1 L homeolog antikoerper, PRF1 antikoerper, Prf1 antikoerper, LOC443187 antikoerper, prf1 antikoerper, prf1.L antikoerper
- Hintergrund
- PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- Apoptose, Caspase Kaskade in der Apoptose
-