GADD45B Antikörper (Middle Region)

Produktnummer ABIN634503

Produktdetails anti-GADD45B Antikörper

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GADD45B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GADD45 B antibody was raised against the middle region of GADD45

Aufreinigung: Affinity purified

Immunogen: GADD45 B antibody was raised using the middle region of GADD45 corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GADD45B Blocking Peptide, catalog no. 33R-2851, is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADD40 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GADD45B

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Andere Bezeichnung: GADD45B (GADD45B Produkte)

Synonyme: GADD45BETA antikoerper, MYD118 antikoerper, AI323528 antikoerper, Myd118 antikoerper, CS131 antikoerper, cb196 antikoerper, gadd45b antikoerper, gadd45b2 antikoerper, sb:cb196 antikoerper, zgc:73104 antikoerper, gadd45beta antikoerper, wu:fa92d10 antikoerper, wu:fa98h12 antikoerper, wu:fk65h03 antikoerper, zgc:111973 antikoerper, gadd45b1 antikoerper, gadd45bl antikoerper, zgc:112453 antikoerper, growth arrest and DNA damage inducible beta antikoerper, growth arrest and DNA-damage-inducible 45 beta antikoerper, growth arrest and DNA-damage-inducible, beta antikoerper, growth arrest and DNA-damage-inducible, beta a antikoerper, growth arrest and DNA-damage-inducible, beta b antikoerper, GADD45B antikoerper, Gadd45b antikoerper, gadd45ba antikoerper, gadd45bb antikoerper

Hintergrund: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Molekulargewicht: 18 kDa (MW of target protein)

Pathways: Zellzyklus