TRAF7 Antikörper (N-Term)

Produktnummer ABIN634504

Produktdetails anti-TRAF7 Antikörper

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAF7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAF7 antibody was raised against the N terminal of TRAF7

Aufreinigung: Affinity purified

Immunogen: TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAF7 Blocking Peptide, catalog no. 33R-3462, is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAF7

Target: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Andere Bezeichnung: TRAF7 (TRAF7 Produkte)

Synonyme: rfwd1 antikoerper, MGC52680 antikoerper, im:7149067 antikoerper, zgc:158391 antikoerper, RFWD1 antikoerper, RNF119 antikoerper, RGD1559653 antikoerper, TNF receptor associated factor 7 S homeolog antikoerper, TNF receptor associated factor 7 antikoerper, TNF receptor-associated factor 7 antikoerper, traf7.S antikoerper, TRAF7 antikoerper, traf7 antikoerper, Traf7 antikoerper

Hintergrund: Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.

Molekulargewicht: 74 kDa (MW of target protein)