DAP Kinase 1 Antikörper (N-Term)

Produktnummer ABIN634506

Produktdetails anti-DAP Kinase 1 Antikörper

Target: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAP Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAPK1 antibody was raised against the N terminal of DAPK1

Aufreinigung: Affinity purified

Immunogen: DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAPK1 Blocking Peptide, catalog no. 33R-6570, is also available for use as a blocking control in assays to test for specificity of this DAPK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAP Kinase 1

Target: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Andere Bezeichnung: DAPK1 (DAPK1 Produkte)

Hintergrund: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160 kDa calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Molekulargewicht: 157 kDa (MW of target protein)

Pathways: MAPK Signalweg, Interferon-gamma Pathway