LGALS1/Galectin 1 Antikörper
-
- Target Alle LGALS1/Galectin 1 (LGALS1) Antikörper anzeigen
- LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LGALS1/Galectin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
- Top Product
- Discover our top product LGALS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LGALS1 Blocking Peptide, catalog no. 33R-2676, is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))
- Andere Bezeichnung
- LGALS1 (LGALS1 Produkte)
- Synonyme
- GAL1 antikoerper, GBP antikoerper, Galectin-1 antikoerper, LGAS1 antikoerper, LGALS1 antikoerper, MGC64502 antikoerper, GB10026 antikoerper, AA410090 antikoerper, Gal-1 antikoerper, Galbp antikoerper, L-14.5 antikoerper, L14 antikoerper, Lect14 antikoerper, galectin-1 antikoerper, Galaptin antikoerper, galectin 1 antikoerper, galectin-1 antikoerper, lectin, galactoside-binding, soluble, 1 L homeolog antikoerper, protein enabled antikoerper, lectin, galactose binding, soluble 1 antikoerper, LGALS1 antikoerper, Lgals1 antikoerper, CC1G_05003 antikoerper, CC1G_05004 antikoerper, lgals1.L antikoerper, LOC408848 antikoerper
- Hintergrund
- The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-