ADRB1 Antikörper (Middle Region)
-
- Target Alle ADRB1 Antikörper anzeigen
- ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADRB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADRB1 antibody was raised against the middle region of ADRB1
- Aufreinigung
- Affinity purified
- Immunogen
- ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
- Top Product
- Discover our top product ADRB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADRB1 Blocking Peptide, catalog no. 33R-1826, is also available for use as a blocking control in assays to test for specificity of this ADRB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADRB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADRB1 (Adrenergic, beta-1-, Receptor (ADRB1))
- Andere Bezeichnung
- ADRB1 (ADRB1 Produkte)
- Synonyme
- ADRB1R antikoerper, B1AR antikoerper, BETA1AR antikoerper, RHR antikoerper, RATB1AR antikoerper, X-Beta1AR antikoerper, BAR1 antikoerper, zgc:194728 antikoerper, zgc:194731 antikoerper, ADRB1 antikoerper, Adrb-1 antikoerper, beta-AR antikoerper, adrenoceptor beta 1 antikoerper, adrenoceptor beta 1 L homeolog antikoerper, adrenergic, beta-1-, receptor antikoerper, adrenergic receptor, beta 1 antikoerper, ADRB1 antikoerper, Adrb1 antikoerper, adrb1.L antikoerper, adrb1 antikoerper
- Hintergrund
- The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process, Cellular Glucan Metabolic Process, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma, Brown Fat Cell Differentiation
-