GPR177/WLS Antikörper (Middle Region)
-
- Target Alle GPR177/WLS (WLS) Antikörper anzeigen
- GPR177/WLS (WLS) (Wntless Homolog (WLS))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GPR177/WLS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPR177 antibody was raised against the middle region of GPR177
- Aufreinigung
- Affinity purified
- Immunogen
- GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
- Top Product
- Discover our top product WLS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPR177 Blocking Peptide, catalog no. 33R-2005, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPR177/WLS (WLS) (Wntless Homolog (WLS))
- Andere Bezeichnung
- GPR177 (WLS Produkte)
- Synonyme
- C1orf139 antikoerper, EVI antikoerper, GPR177 antikoerper, MRP antikoerper, mig-14 antikoerper, 5031439A09Rik antikoerper, AI173978 antikoerper, AI987742 antikoerper, Gpr177 antikoerper, gpr117 antikoerper, gpr177 antikoerper, sb:cb610 antikoerper, wu:fb36d04 antikoerper, wu:fb44d10 antikoerper, wu:fb50c06 antikoerper, zgc:64091 antikoerper, CG6210 antikoerper, Dmel\\CG6210 antikoerper, Evi antikoerper, Evi/Wls antikoerper, Srt antikoerper, Wls antikoerper, Wls/Evi antikoerper, evi antikoerper, srt antikoerper, wls/evi antikoerper, wntless Wnt ligand secretion mediator antikoerper, wntless homolog (Drosophila) antikoerper, wntless antikoerper, WLS antikoerper, Wls antikoerper, wls antikoerper
- Hintergrund
- GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
- Molekulargewicht
- 62 kDa (MW of target protein)
- Pathways
- WNT Signalweg
-