ATL2 Antikörper (C-Term)
-
- Target Alle ATL2 Antikörper anzeigen
- ATL2 (Atlastin GTPase 2 (ATL2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ARL6 IP2 antibody was raised against the C terminal of ARL6 P2
- Aufreinigung
- Affinity purified
- Immunogen
- ARL6 IP2 antibody was raised using the C terminal of ARL6 P2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ
- Top Product
- Discover our top product ATL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARL6IP2 Blocking Peptide, catalog no. 33R-5950, is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 P2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATL2 (Atlastin GTPase 2 (ATL2))
- Andere Bezeichnung
- ARL6IP2 (ATL2 Produkte)
- Hintergrund
- ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.
- Molekulargewicht
- 66 kDa (MW of target protein)
-