FKBP8 Antikörper (C-Term)
-
- Target Alle FKBP8 Antikörper anzeigen
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FKBP8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FKBP8 antibody was raised against the C terminal of FKBP8
- Aufreinigung
- Affinity purified
- Immunogen
- FKBP8 antibody was raised using the C terminal of FKBP8 corresponding to a region with amino acids AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL
- Top Product
- Discover our top product FKBP8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FKBP8 Blocking Peptide, catalog no. 33R-1277, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
- Andere Bezeichnung
- FKBP8 (FKBP8 Produkte)
- Synonyme
- FKBP8 antikoerper, fkbp8 antikoerper, 38kDa antikoerper, FKBP-38 antikoerper, FKBP-8 antikoerper, Fkbp38 antikoerper, zgc:77672 antikoerper, FKBP38 antikoerper, FKBPr38 antikoerper, FK506 binding protein 8 antikoerper, FK506 binding protein 8 L homeolog antikoerper, FKBP8 antikoerper, fkbp8 antikoerper, Fkbp8 antikoerper, fkbp8.L antikoerper
- Hintergrund
- FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.
- Molekulargewicht
- 45 kDa (MW of target protein)
- Pathways
- Autophagie
-