RHOT1 Antikörper (N-Term)

Produktnummer ABIN634526

Produktdetails anti-RHOT1 Antikörper

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RHOT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RHOT1 antibody was raised against the N terminal of RHOT1

Aufreinigung: Affinity purified

Immunogen: RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RHOT1 Blocking Peptide, catalog no. 33R-6147, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RHOT1

Target: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Andere Bezeichnung: RHOT1 (RHOT1 Produkte)

Synonyme: rhot1 antikoerper, zgc:55581 antikoerper, zgc:77063 antikoerper, wu:fd14e11 antikoerper, wu:fi14a05 antikoerper, arht2 antikoerper, miro-2 antikoerper, rasl antikoerper, ARHT1 antikoerper, MIRO-1 antikoerper, MIRO1 antikoerper, 2210403N23Rik antikoerper, AA415293 antikoerper, AF244542 antikoerper, AI834919 antikoerper, Arht1 antikoerper, C430039G08Rik antikoerper, Miro1 antikoerper, miro1 antikoerper, si:dkeyp-97g3.6 antikoerper, ras homolog family member T1a antikoerper, ras homolog family member T2 antikoerper, ras homolog family member T1 antikoerper, ras homolog family member T1 L homeolog antikoerper, rhot1a antikoerper, rhot2 antikoerper, RHOT1 antikoerper, rhot1 antikoerper, rhot1.L antikoerper, Rhot1 antikoerper, rhot1b antikoerper

Hintergrund: Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Molekulargewicht: 71 kDa (MW of target protein)