ADCY6 Antikörper (C-Term)
-
- Target Alle ADCY6 Antikörper anzeigen
- ADCY6 (Adenylate Cyclase 6 (ADCY6))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADCY6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ADCY6 antibody was raised against the C terminal of ADCY6
- Aufreinigung
- Affinity purified
- Immunogen
- ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY
- Top Product
- Discover our top product ADCY6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADCY6 Blocking Peptide, catalog no. 33R-5069, is also available for use as a blocking control in assays to test for specificity of this ADCY6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADCY6 (Adenylate Cyclase 6 (ADCY6))
- Andere Bezeichnung
- ADCY6 (ADCY6 Produkte)
- Synonyme
- ADCY6 antikoerper, adcy6 antikoerper, AC6 antikoerper, mKIAA0422 antikoerper, ACVI antikoerper, ADCYB antikoerper, adenylate cyclase 6 L homeolog antikoerper, adenylate cyclase 6 antikoerper, adenylate cyclase 6a antikoerper, adcy6.L antikoerper, ADCY6 antikoerper, adcy6a antikoerper, adcy6 antikoerper, Adcy6 antikoerper
- Hintergrund
- ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors, and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.
- Molekulargewicht
- 125 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
-