ADCY6 Antikörper (C-Term)

Produktnummer ABIN634528

Produktdetails anti-ADCY6 Antikörper

Target: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADCY6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ADCY6 antibody was raised against the C terminal of ADCY6

Aufreinigung: Affinity purified

Immunogen: ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADCY6 Blocking Peptide, catalog no. 33R-5069, is also available for use as a blocking control in assays to test for specificity of this ADCY6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADCY6

Target: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Andere Bezeichnung: ADCY6 (ADCY6 Produkte)

Synonyme: ADCY6 antikoerper, adcy6 antikoerper, AC6 antikoerper, mKIAA0422 antikoerper, ACVI antikoerper, ADCYB antikoerper, adenylate cyclase 6 L homeolog antikoerper, adenylate cyclase 6 antikoerper, adenylate cyclase 6a antikoerper, adcy6.L antikoerper, ADCY6 antikoerper, adcy6a antikoerper, adcy6 antikoerper, Adcy6 antikoerper

Hintergrund: ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors, and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.

Molekulargewicht: 125 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma