ADCY8 Antikörper

Produktnummer ABIN634530

Produktdetails anti-ADCY8 Antikörper

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADCY8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADCY8 Blocking Peptide, catalog no. 33R-2494, is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADCY8

Target: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Andere Bezeichnung: ADCY8 (ADCY8 Produkte)

Synonyme: MGC121231 antikoerper, si:ch211-220f13.4 antikoerper, AC8 antikoerper, AW060868 antikoerper, ADCY3 antikoerper, HBAC1 antikoerper, Ac8 antikoerper, adenylate cyclase 8 (brain) S homeolog antikoerper, adenylate cyclase 8 antikoerper, adenylate cyclase 8 (brain) antikoerper, adenylate cyclase type 8 antikoerper, adenylate cyclase 3 antikoerper, adcy8.S antikoerper, ADCY8 antikoerper, adcy8 antikoerper, LOC100461383 antikoerper, Adcy8 antikoerper, ADCY3 antikoerper

Hintergrund: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Molekulargewicht: 140 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma